PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011085513.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family Dof
Protein Properties Length: 216aa    MW: 22261.6 Da    PI: 8.5878
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011085513.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.81.2e-382382362
          zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                     ++l+cprCdstntkfCyynny+ sqPr+fCk+CrryWt+GG+lr++PvGgg+rkn k+s
  XP_011085513.1 23 PEHLPCPRCDSTNTKFCYYNNYNFSQPRHFCKSCRRYWTHGGTLRDIPVGGGSRKNAKRS 82
                    57899***************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027012.1E-332580IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.2642680IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102864IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-233080IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MATDTSLRKA TKSAQVGAPP PEPEHLPCPR CDSTNTKFCY YNNYNFSQPR HFCKSCRRYW  60
THGGTLRDIP VGGGSRKNAK RSRTSISSSA TTSGGGASVY SSXVIIMAAD QGGVVPYVSE  120
GKMSGSFTSL LNSSQGSGLL ALGGFGLGLG LDEVGFGLGR AVWPFAGVVE GGPTSGSGGV  180
AGQTWQLENG EGGFVGGGDC FAWPDLAIST PGSVMK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ8572516e-65DQ857251.1 Glycine max Dof2 mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011085513.11e-156PREDICTED: LOW QUALITY PROTEIN: dof zinc finger protein DOF3.4
SwissprotQ390883e-54DOF34_ARATH; Dof zinc finger protein DOF3.4
TrEMBLA0A022RWC05e-89A0A022RWC0_ERYGU; Uncharacterized protein
STRINGGLYMA02G06970.21e-80(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45322241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50410.12e-31OBF binding protein 1